Lineage for d6giha_ (6gih A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. Protein Protein kinase CK2, alpha subunit [56142] (3 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. Species Human (Homo sapiens) [TaxId:9606] [75559] (180 PDB entries)
  8. Domain d6giha_: 6gih A: [352642]
    automated match to d3h30a_
    complexed with act, ezn

Details for d6giha_

PDB Entry: 6gih (more details), 1.96 Å

PDB Description: crystal structure of ck2alpha with cam187 bound
PDB Compounds: (A:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d6giha_:

Sequence, based on SEQRES records: (download)

>d6giha_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
gpvpsrarvytdvnthrpseywdyeshvvewgnqddyqlvrklgrgkysevfeainitnn
ekvvvkilkpvaaakikreikilenlrggpniitladivkdpvsrtpalvfehvnntdfk
qlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaefy
hpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydql
vriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfld
kllrydhqsrltareamehpyfytvvk

Sequence, based on observed residues (ATOM records): (download)

>d6giha_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
gpvpsrarvytdvnthrpseywdyeshvvewgnqddyqlvrklgrgkysevfeainitnn
ekvvvkilkpvaaakikreikilenlrggpniitladivkdpvsrtpalvfehvnnkqly
qtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaefyhpg
qeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydqlvri
akvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfldkll
rydhqsrltareamehpyfytvvk

SCOPe Domain Coordinates for d6giha_ are not available.

Timeline for d6giha_: