Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.2: Aspartate/glutamate racemase [53681] (2 families) |
Family c.78.2.1: Aspartate/glutamate racemase [53682] (2 proteins) C-terminal extension is added to the N-terminal domain |
Protein Glutamate racemase [53683] (1 species) |
Species Aquifex pyrophilus [TaxId:2714] [53684] (2 PDB entries) |
Domain d1b74a1: 1b74 A:1-105 [35264] complexed with dgn |
PDB Entry: 1b74 (more details), 2.3 Å
SCOPe Domain Sequences for d1b74a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b74a1 c.78.2.1 (A:1-105) Glutamate racemase {Aquifex pyrophilus [TaxId: 2714]} mkigifdsgvggltvlkairnryrkvdivylgdtarvpygirskdtiiryslecagflkd kgvdiivvacntasayalerlkkeinvpvfgviepgvkealkksr
Timeline for d1b74a1: