SCOPe 2.06: Domain d1b74a1: 1b74 A:1-105

Lineage for d1b74a1 (1b74 A:1-105)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.2: Aspartate/glutamate racemase [53681] (2 families)

5. Family c.78.2.1: Aspartate/glutamate racemase [53682] (2 proteins)
   C-terminal extension is added to the N-terminal domain

6. Protein Glutamate racemase [53683] (1 species)

7. Species Aquifex pyrophilus [TaxId:2714] [53684] (2 PDB entries)

8. Domain d1b74a1: 1b74 A:1-105 [35264]
   complexed with dgn

Details for d1b74a1

PDB Entry: 1b74, 2.3 Å

PDB Description: glutamate racemase from aquifex pyrophilus

PDB Compounds: (A:) glutamate racemase

SCOPe Domain Sequences for d1b74a1:

Sequence; same for both SEQRES and ATOM records:

>d1b74a1 c.78.2.1 (A:1-105) Glutamate racemase {Aquifex pyrophilus [TaxId: 2714]}
mkigifdsgvggltvlkairnryrkvdivylgdtarvpygirskdtiiryslecagflkd
kgvdiivvacntasayalerlkkeinvpvfgviepgvkealkksr

Timeline for d1b74a1:

• d1b74a1 first appeared (with stable ids) in SCOP 1.55
  
• d1b74a1 appears in SCOPe 2.05
  
• d1b74a1 appears in SCOPe 2.07
  
• d1b74a1 appears in the current release, SCOPe 2.08