| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.6: Cadherin-like [49313] (4 families) ![]() |
| Family b.1.6.0: automated matches [191376] (1 protein) not a true family |
| Protein automated matches [190458] (4 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [187373] (16 PDB entries) |
| Domain d5vt8b1: 5vt8 B:2481-2580 [352630] automated match to d5i8da2 complexed with ca |
PDB Entry: 5vt8 (more details), 2.92 Å
SCOPe Domain Sequences for d5vt8b1:
Sequence, based on SEQRES records: (download)
>d5vt8b1 b.1.6.0 (B:2481-2580) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dcrpqfskpqfstsvyenepagtsvitmlatdqdegsnsqltyslegpgmeafsvdmdsg
lvttqrplqsyerfnltvvatdggepplwgttmllvevid
>d5vt8b1 b.1.6.0 (B:2481-2580) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dcrpqfskpqfstsvyenepagtsvitmlatdqsqltyslegpgmeafsvdmdsglvttq
rplqsyerfnltvvatdggepplwgttmllvevid
Timeline for d5vt8b1: