SCOPe 2.07: Domain d6bbda2: 6bbd A:235-358

Lineage for d6bbda2 (6bbd A:235-358)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Surfactant protein, lectin domain [56461] (3 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [226409] (3 PDB entries)

8. Domain d6bbda2: 6bbd A:235-358 [352629]
   Other proteins in same PDB: d6bbda1
   automated match to d1pwba1
   complexed with bma, ca, gol, man, nag

Details for d6bbda2

PDB Entry: 6bbd, 1.9 Å

PDB Description: structure of n-glycosylated porcine surfactant protein-d complexed with glycerol

PDB Compounds: (A:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d6bbda2:

Sequence; same for both SEQRES and ATOM records:

>d6bbda2 d.169.1.1 (A:235-358) Surfactant protein, lectin domain {Pig (Sus scrofa) [TaxId: 9823]}
pngrgvgekifktggfektfqdaqqvctqaggqmasprsetenealsqlvtaqnkaafls
mtdiktegnftyptgeplvyanwapgepnnnggssgaencveifpngkwndkacgelrlv
icef

Timeline for d6bbda2:

• d6bbda2 is new in SCOPe 2.07-stable
  
• d6bbda2 appears in the current release, SCOPe 2.08