Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein Surfactant protein, lectin domain [56461] (3 species) |
Species Pig (Sus scrofa) [TaxId:9823] [226409] (3 PDB entries) |
Domain d6bbda2: 6bbd A:235-358 [352629] Other proteins in same PDB: d6bbda1 automated match to d1pwba1 complexed with bma, ca, gol, man, nag |
PDB Entry: 6bbd (more details), 1.9 Å
SCOPe Domain Sequences for d6bbda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bbda2 d.169.1.1 (A:235-358) Surfactant protein, lectin domain {Pig (Sus scrofa) [TaxId: 9823]} pngrgvgekifktggfektfqdaqqvctqaggqmasprsetenealsqlvtaqnkaafls mtdiktegnftyptgeplvyanwapgepnnnggssgaencveifpngkwndkacgelrlv icef
Timeline for d6bbda2: