SCOPe 2.08: Domain d6bbda1: 6bbd A:205-234

Lineage for d6bbda1 (6bbd A:205-234)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family)

5. Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)

6. Protein Surfactant protein [57949] (3 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [352369] (2 PDB entries)

8. Domain d6bbda1: 6bbd A:205-234 [352628]
   Other proteins in same PDB: d6bbda2
   automated match to d4e52a1
   complexed with ca, gol

Details for d6bbda1

PDB Entry: 6bbd, 1.9 Å

PDB Description: structure of n-glycosylated porcine surfactant protein-d complexed with glycerol

PDB Compounds: (A:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d6bbda1:

Sequence; same for both SEQRES and ATOM records:

>d6bbda1 h.1.1.1 (A:205-234) Surfactant protein {Pig (Sus scrofa) [TaxId: 9823]}
talrqqvetlqgqvqrlqkafsqykkvelf

Timeline for d6bbda1:

• d6bbda1 first appeared in SCOPe 2.07