![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) ![]() |
![]() | Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins) |
![]() | Protein Surfactant protein [57949] (3 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [352369] (2 PDB entries) |
![]() | Domain d6bbda1: 6bbd A:205-234 [352628] Other proteins in same PDB: d6bbda2 automated match to d4e52a1 complexed with ca, gol |
PDB Entry: 6bbd (more details), 1.9 Å
SCOPe Domain Sequences for d6bbda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bbda1 h.1.1.1 (A:205-234) Surfactant protein {Pig (Sus scrofa) [TaxId: 9823]} talrqqvetlqgqvqrlqkafsqykkvelf
Timeline for d6bbda1: