SCOPe 2.07: Domain d5yisb_: 5yis B:

Lineage for d5yisb_ (5yis B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.3: GABARAP-like [54253] (4 proteins)
   intracellular membrane trafficking and fusion proteins
   automatically mapped to Pfam PF02991

6. Protein automated matches [190358] (6 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [352580] (4 PDB entries)

8. Domain d5yisb_: 5yis B: [352625]
   automated match to d2zjdc_
   complexed with gol, po4

Details for d5yisb_

PDB Entry: 5yis, 2.2 Å

PDB Description: crystal structure of ankb lir/lc3b complex

PDB Compounds: (B:) Microtubule-associated proteins 1A/1B light chain 3B

SCOPe Domain Sequences for d5yisb_:

Sequence; same for both SEQRES and ATOM records:

>d5yisb_ d.15.1.3 (B:) automated matches {Mus musculus [TaxId: 10090]}
ektfkqrrsfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpdhvnmsel
ikiirrrlqlnanqaffllvnghsmvsvstpisevyeserdedgflymvyasqetfgtam
av

Timeline for d5yisb_:

• d5yisb_ is new in SCOPe 2.07-stable
  
• d5yisb_ appears in the current release, SCOPe 2.08