Lineage for d1c9ya1 (1c9y A:34-184)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2513848Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2513849Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2513850Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. 2514165Protein Ornithine transcarbamoylase [53676] (6 species)
  7. 2514197Species Human (Homo sapiens) [TaxId:9606] [53680] (4 PDB entries)
  8. 2514200Domain d1c9ya1: 1c9y A:34-184 [35262]
    complexed with cp, nva

Details for d1c9ya1

PDB Entry: 1c9y (more details), 1.9 Å

PDB Description: human ornithine transcarbamylase: crystallographic insights into substrate recognition and catalytic mechanism
PDB Compounds: (A:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d1c9ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c9ya1 c.78.1.1 (A:34-184) Ornithine transcarbamoylase {Human (Homo sapiens) [TaxId: 9606]}
kvqlkgrdlltlknftgeeikymlwlsadlkfrikqkgeylpllqgkslgmifekrstrt
rlstetgfallgghpcflttqdihlgvnesltdtarvlssmadavlarvykqsdldtlak
easipiinglsdlyhpiqiladyltlqehys

SCOPe Domain Coordinates for d1c9ya1:

Click to download the PDB-style file with coordinates for d1c9ya1.
(The format of our PDB-style files is described here.)

Timeline for d1c9ya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c9ya2