SCOPe 2.05: Domain d1c9ya1: 1c9y A:34-184

Lineage for d1c9ya1 (1c9y A:34-184)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)

6. Protein Ornithine transcarbamoylase [53676] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53680] (4 PDB entries)

8. Domain d1c9ya1: 1c9y A:34-184 [35262]
   complexed with cp, nva

Details for d1c9ya1

PDB Entry: 1c9y, 1.9 Å

PDB Description: human ornithine transcarbamylase: crystallographic insights into substrate recognition and catalytic mechanism

PDB Compounds: (A:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d1c9ya1:

Sequence; same for both SEQRES and ATOM records:

>d1c9ya1 c.78.1.1 (A:34-184) Ornithine transcarbamoylase {Human (Homo sapiens) [TaxId: 9606]}
kvqlkgrdlltlknftgeeikymlwlsadlkfrikqkgeylpllqgkslgmifekrstrt
rlstetgfallgghpcflttqdihlgvnesltdtarvlssmadavlarvykqsdldtlak
easipiinglsdlyhpiqiladyltlqehys

Timeline for d1c9ya1:

• d1c9ya1 first appeared (with stable ids) in SCOP 1.55
  
• d1c9ya1 appears in SCOPe 2.04
  
• d1c9ya1 appears in SCOPe 2.06
  
• d1c9ya1 appears in the current release, SCOPe 2.08