Lineage for d1c9ya1 (1c9y A:34-184)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.78: ATC-like [53670] (2 superfamilies) Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) 
Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (2 proteins) Protein Ornithine transcarbamoylase [53676] (4 species) 
Species Human (Homo sapiens) [TaxId:9606] [53680] (2 PDB entries) 
Domain d1c9ya1: 1c9y A:34-184 [35262]
Details for d1c9ya1
PDB Entry: 1c9y (more details), 1.9 Å
PDB Description: human ornithine transcarbamylase: crystallographic insights into substrate recognition and catalytic mechanism
SCOP Domain Sequences for d1c9ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c9ya1 c.78.1.1 (A:34-184) Ornithine transcarbamoylase {Human (Homo sapiens)}
kvqlkgrdlltlknftgeeikymlwlsadlkfrikqkgeylpllqgkslgmifekrstrt
rlstetgfallgghpcflttqdihlgvnesltdtarvlssmadavlarvykqsdldtlak
easipiinglsdlyhpiqiladyltlqehys
SCOP Domain Coordinates for d1c9ya1:
Click to download the PDB-style file with coordinates for d1c9ya1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c9ya1:
- d1c9ya1 appears in SCOP 1.57
- d1c9ya1 appears in the current release, SCOPe 2.08
View in 3D
