![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
![]() | Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) |
![]() | Protein Ornithine transcarbamoylase [53676] (6 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [53680] (4 PDB entries) |
![]() | Domain d1c9ya1: 1c9y A:34-184 [35262] complexed with cp, nva |
PDB Entry: 1c9y (more details), 1.9 Å
SCOPe Domain Sequences for d1c9ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c9ya1 c.78.1.1 (A:34-184) Ornithine transcarbamoylase {Human (Homo sapiens) [TaxId: 9606]} kvqlkgrdlltlknftgeeikymlwlsadlkfrikqkgeylpllqgkslgmifekrstrt rlstetgfallgghpcflttqdihlgvnesltdtarvlssmadavlarvykqsdldtlak easipiinglsdlyhpiqiladyltlqehys
Timeline for d1c9ya1: