Lineage for d5vwga_ (5vwg A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (63 species)
    not a true protein
  7. 2375328Species Human (Homo sapiens) [TaxId:9606] [187655] (101 PDB entries)
  8. 3052553Domain d5vwga_: 5vwg A: [352615]
    automated match to d3apba_
    complexed with 9qg

Details for d5vwga_

PDB Entry: 5vwg (more details), 2.1 Å

PDB Description: galectin-8 n terminal domain in complex with methyl 3-o-[1- carboxyethyl]-beta-d-galactopyranoside
PDB Compounds: (A:) Galectin-8

SCOPe Domain Sequences for d5vwga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vwga_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssvkpradvafhfn
prfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtllyg
hrigpekidtlgiygkvnihsigfsfs

SCOPe Domain Coordinates for d5vwga_:

Click to download the PDB-style file with coordinates for d5vwga_.
(The format of our PDB-style files is described here.)

Timeline for d5vwga_:

  • d5vwga_ is new in SCOPe 2.07-stable