Lineage for d6d85b_ (6d85 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332578Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
    multihelical
  4. 2332579Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) (S)
  5. 2332580Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (6 proteins)
    Pfam PF00620
  6. 2332603Protein automated matches [334155] (2 species)
    not a true protein
  7. 3052329Species Bos taurus [TaxId:9913] [352391] (6 PDB entries)
  8. 3052548Domain d6d85b_: 6d85 B: [352610]
    automated match to d1pbwb_
    complexed with so4; mutant

Details for d6d85b_

PDB Entry: 6d85 (more details), 2.2 Å

PDB Description: structure of the bovine p85a bh domain e217k mutant
PDB Compounds: (B:) Phosphatidylinositol 3-kinase regulatory subunit alpha

SCOPe Domain Sequences for d6d85b_:

Sequence, based on SEQRES records: (download)

>d6d85b_ a.116.1.1 (B:) automated matches {Bos taurus [TaxId: 9913]}
stlpdlaeqfappdvapplliklveaiekkglecstlyrtqsssnpaelrqlldcdtasl
dlemfdvhvladafkrylldlpnpvipvavsselislapevqsskeyiqllkklirspsi
phqywltlqyllkhffklsqtssknllnarvlselfspllfrfpaassentehlikiiei
liste

Sequence, based on observed residues (ATOM records): (download)

>d6d85b_ a.116.1.1 (B:) automated matches {Bos taurus [TaxId: 9913]}
stlpdlaeqfappdvapplliklveaiekkglecstlyrtqsssnpaelrqlldcldlem
fdvhvladafkrylldlpnpvipvavsselislapevqsskeyiqllkklirspsiphqy
wltlqyllkhffklsqtssknllnarvlselfspllfrfpentehlikiieiliste

SCOPe Domain Coordinates for d6d85b_:

Click to download the PDB-style file with coordinates for d6d85b_.
(The format of our PDB-style files is described here.)

Timeline for d6d85b_:

  • d6d85b_ is new in SCOPe 2.07-stable