SCOPe 2.07: Domain d5xoha2: 5xoh A:115-355

Lineage for d5xoha2 (5xoh A:115-355)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (81 species)
   not a true protein

7. Species Peucedanum praeruptorum [TaxId:312531] [352605] (1 PDB entry)

8. Domain d5xoha2: 5xoh A:115-355 [352606]
   Other proteins in same PDB: d5xoha1
   automated match to d3reoa2
   complexed with 8b6, sah

Details for d5xoha2

PDB Entry: 5xoh, 2.2 Å

PDB Description: crystal structure of bergaptol o-methyltransferase complex

PDB Compounds: (A:) Bergaptol O-methyltransferase

SCOPe Domain Sequences for d5xoha2:

Sequence; same for both SEQRES and ATOM records:

>d5xoha2 c.66.1.0 (A:115-355) automated matches {Peucedanum praeruptorum [TaxId: 312531]}
dgasiaplllvhqdqvpmkswyhltdaildggtafnkaygmnifdyasqdpqfnkvfnrs
maghstitmkkiletyngfeglksivdvgggsgatlnmiiskyptikginfdlphvvgds
pihpgvehvggdmfasvpkgdaiflkwifhswsdedclrilkncyealadnkkvivaefi
ipevpggsddatksvvhldavmlayvpggkertekefealatsagfksfrkvccafntwi
m

Timeline for d5xoha2:

• d5xoha2 is new in SCOPe 2.07-stable
  
• d5xoha2 appears in the current release, SCOPe 2.08