Lineage for d6b5da_ (6b5d A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (156 species)
    not a true protein
  7. 2452697Species Nematode (Caenorhabditis elegans) [TaxId:6239] [346304] (8 PDB entries)
  8. 3052540Domain d6b5da_: 6b5d A: [352602]
    automated match to d4l15a_
    complexed with adp

Details for d6b5da_

PDB Entry: 6b5d (more details), 3.1 Å

PDB Description: structural basis for katanin self-assembly
PDB Compounds: (A:) Meiotic spindle formation protein mei-1

SCOPe Domain Sequences for d6b5da_:

Sequence, based on SEQRES records: (download)

>d6b5da_ c.37.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
sfdasaydayivqavrgtmatntentmslddiigmhdvkqvlheavtlpllvpeffqglr
spwkamvlagppgtgktliaraiasessstfftvsstdlsskwrgdsekivrllfelarf
yapsiifideidtlggqrgnsgeheasrrvkseflvqmdgsqnkfdsrrvfvlaatnipw
eldealrrrfekrifiplpdidarkklieksmegtpksdeinyddlaartegfsgadvvs
lcrtaainvlrrydtkslrggeltaameslkaelvrnidfeaalqavspsagpdtmlkck
ewcds

Sequence, based on observed residues (ATOM records): (download)

>d6b5da_ c.37.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
sfdasaydayivqavrgtmatntentmslddiigmhdvkqvlheavtlpllvpeffqglr
spwkamvlagppgtgktliaraiasessstfftvsstdlssksekivrllfelarfyaps
iifideidtlgeasrrvkseflvqmdgsqrvfvlaatnipweldealrrrfekrifiplp
didarkklieksmegtpksdeinyddlaartegfsgadvvslcrtaainvlrrydtkslr
ggeltaameslkaelvrnidfeaalqavspsagpdtmlkckewcds

SCOPe Domain Coordinates for d6b5da_:

Click to download the PDB-style file with coordinates for d6b5da_.
(The format of our PDB-style files is described here.)

Timeline for d6b5da_:

  • d6b5da_ is new in SCOPe 2.07-stable