Lineage for d5ygya_ (5ygy A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. Protein beta-secretase (memapsin) [50671] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [50672] (329 PDB entries)
    Uniprot P56817 58-446 ! Uniprot P56817 60-447
  8. Domain d5ygya_: 5ygy A: [352600]
    automated match to d3kmxa_
    complexed with 0b6, gol, iod

Details for d5ygya_

PDB Entry: 5ygy (more details), 2.3 Å

PDB Description: crystal structure of bace1 in complex with (s)-n-(3-(2-amino-6- (fluoromethyl)-4 -methyl-4h-1,3-oxazin-4-yl)-4-fluorophenyl)-5- cyanopicolinamide
PDB Compounds: (A:) Beta-secretase 1

SCOPe Domain Sequences for d5ygya_:

Sequence, based on SEQRES records: (download)

>d5ygya_ b.50.1.2 (A:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
grrgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyq
rqlsstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffings
nwegilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggs
miiggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttn
lrlpkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtn
qsfritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrig
favsachvhdefrtaavegpfvtldmedcgyn

Sequence, based on observed residues (ATOM records): (download)

>d5ygya_ b.50.1.2 (A:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
grrgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyq
rqlsstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffings
nwegilglayaeiarpddslepffdslvkqthvpnlfslqlcgasvggsmiiggidhsly
tgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfeaa
vksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfritilpqq
ylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhde
frtaavegpfvtldmedcgyn

SCOPe Domain Coordinates for d5ygya_ are not available.

Timeline for d5ygya_: