Lineage for d5ymub_ (5ymu B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (63 species)
    not a true protein
  7. 3052533Species Porcine rotavirus a [TaxId:10967] [352595] (1 PDB entry)
  8. 3052534Domain d5ymub_: 5ymu B: [352596]
    automated match to d5gj6a_
    complexed with gol

Details for d5ymub_

PDB Entry: 5ymu (more details), 1.8 Å

PDB Description: functional and structural characterization of p[19] rotavirus vp8* interaction with histo-blood group antigens
PDB Compounds: (B:) Outer capsid protein VP4

SCOPe Domain Sequences for d5ymub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ymub_ b.29.1.0 (B:) automated matches {Porcine rotavirus a [TaxId: 10967]}
vldgpyqptrfkppndywillsptnqqvvlegtnrtdvwvalllvepnvtnqsrqytlfg
etkqitvenntnkwkfyemfrnsasaefqhkrtltsdtklagflkhggrvwtfygetpha
ttdysstsnlsevetvirtefyiiprsqeskcneyintgl

SCOPe Domain Coordinates for d5ymub_:

Click to download the PDB-style file with coordinates for d5ymub_.
(The format of our PDB-style files is described here.)

Timeline for d5ymub_:

  • d5ymub_ is new in SCOPe 2.07-stable