Lineage for d1a1s_1 (1a1s 1-150)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.78: ATC-like [53670] (2 superfamilies) Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) 
Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (2 proteins) Protein Ornithine transcarbamoylase [53676] (4 species) 
Species Pyrococcus furiosus [TaxId:186497] [53679] (1 PDB entry) 
Domain d1a1s_1: 1a1s 1-150 [35258]
Details for d1a1s_1
PDB Entry: 1a1s (more details), 2.7 Å
PDB Description: ornithine carbamoyltransferase from pyrococcus furiosus
SCOP Domain Sequences for d1a1s_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a1s_1 c.78.1.1 (1-150) Ornithine transcarbamoylase {Pyrococcus furiosus}
vvslagrdllclqdytaeeiwtiletakmfkiwqkigkphrllegktlamifqkpstrtr
vsfevamahlgghalylnaqdlqlrrgetiadtarvlsryvdaimarvydhkdvedlaky
atvpvinglsdfshpcqaladymtiwekkg
SCOP Domain Coordinates for d1a1s_1:
Click to download the PDB-style file with coordinates for d1a1s_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a1s_1:
- d1a1s_1 appears in SCOP 1.57
- d1a1s_1 appears in the current release, SCOPe 2.08, called d1a1sa1
View in 3D
