Lineage for d5offa1 (5off A:8-166)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2771729Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species)
  7. 2771730Species Achromobacter cycloclastes [TaxId:223] [419324] (51 PDB entries)
  8. 2771752Domain d5offa1: 5off A:8-166 [352535]
    Other proteins in same PDB: d5offa2
    automated match to d5i6la1
    complexed with act, cu, no2

Details for d5offa1

PDB Entry: 5off (more details), 1.41 Å

PDB Description: cu nitrite reductase serial data at varying temperatures rt 0.03mgy
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d5offa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5offa1 b.6.1.3 (A:8-166) Nitrite reductase, NIR, N-terminal domain {Achromobacter cycloclastes [TaxId: 223]}
distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs
vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat
kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek

SCOPe Domain Coordinates for d5offa1:

Click to download the PDB-style file with coordinates for d5offa1.
(The format of our PDB-style files is described here.)

Timeline for d5offa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5offa2