Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species) |
Species Achromobacter cycloclastes [TaxId:223] [419325] (60 PDB entries) |
Domain d5og5a2: 5og5 A:167-339 [352534] Other proteins in same PDB: d5og5a1 automated match to d2bw4a2 complexed with act, cu, no, no2 |
PDB Entry: 5og5 (more details), 1.82 Å
SCOPe Domain Sequences for d5og5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5og5a2 b.6.1.3 (A:167-339) Nitrite reductase, NIR, C-terminal domain {Achromobacter cycloclastes [TaxId: 223]} gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvvkpas
Timeline for d5og5a2: