Lineage for d6f4yb_ (6f4y B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins)
    automatically mapped to Pfam PF12680
    automatically mapped to Pfam PF02136
  6. Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (3 species)
  7. Species Pseudomonas putida [TaxId:303] [54437] (61 PDB entries)
    Uniprot P07445
  8. Domain d6f4yb_: 6f4y B: [352530]
    automated match to d5kp4a_

Details for d6f4yb_

PDB Entry: 6f4y (more details), 1.92 Å

PDB Description: crystal structure of ketosteroid isomerase variant d103s
PDB Compounds: (B:) steroid delta-isomerase

SCOPe Domain Sequences for d6f4yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f4yb_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
lptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqglg
ggkvracltgpvrashngcgampfrvemvwngqpcaldvisvmrfdehgriqtmqaywse
vnlsv

SCOPe Domain Coordinates for d6f4yb_ are not available.

Timeline for d6f4yb_:

Domains from other chains:
(mouse over for more information)
d6f4ya_