SCOP 1.73: Domain d2otci2: 2otc I:151-333

Lineage for d2otci2 (2otc I:151-333)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)

6. Protein Ornithine transcarbamoylase [53676] (6 species)

7. Species Escherichia coli [TaxId:562] [53678] (3 PDB entries)

8. Domain d2otci2: 2otc I:151-333 [35251]
   complexed with pao

Details for d2otci2

PDB Entry: 2otc, 2.8 Å

PDB Description: ornithine transcarbamoylase complexed with n-(phosphonacetyl)-l-ornithine

PDB Compounds: (I:) ornithine carbamoyltransferase

SCOP Domain Sequences for d2otci2:

Sequence; same for both SEQRES and ATOM records:

>d2otci2 c.78.1.1 (I:151-333) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]}
kafnemtlvyagdarnnmgnsmleaaaltgldlrlvapqacwpeaalvtecralaqqngg
nitltedvakgvegadfiytdvwvsmgeakekwaeriallreyqvnskmmqltgnpevkf
lhclpafhddqttlgkkmaeefglhggmevtdevfesaasivfdqaenrmhtikavmvat
lsk

Timeline for d2otci2:

• d2otci2 first appeared (with stable ids) in SCOP 1.55
  
• d2otci2 appears in SCOP 1.71
  
• d2otci2 appears in SCOP 1.75
  
• d2otci2 appears in the current release, SCOPe 2.08