Lineage for d6fshd_ (6fsh D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (81 species)
    not a true protein
  7. 2331670Species Actinoplanes teichomyceticus [TaxId:1867] [189592] (6 PDB entries)
  8. 3052439Domain d6fshd_: 6fsh D: [352501]
    automated match to d5y5ga_
    complexed with act, hem, k

Details for d6fshd_

PDB Entry: 6fsh (more details), 2.5 Å

PDB Description: crystal structure of hybrid p450 oxybtei(bc/fgvan)
PDB Compounds: (D:) OxyB protein

SCOPe Domain Sequences for d6fshd_:

Sequence, based on SEQRES records: (download)

>d6fshd_ a.104.1.0 (D:) automated matches {Actinoplanes teichomyceticus [TaxId: 1867]}
ppihtrrqgfdpadelraagtltkisigsgadaettwlaaghavvrqvlgdhqqfstrrr
wdprdeiggkgifrprelvgnlmdydppehtrlrhlltpgftqrrmrrlaprieeivtdr
ldameqagppadlielfadevpgavlceligvprddrdmfmklchghldaslsqkrraal
gdkfsryllamiarerkdpgdgfigsivaehgdtitdeelrgvcvqlmlagddnvsgmig
lgvlallrhpeqiaalrgddqsadravdeliryltvpyaptprtavedvmvadqvikege
tvlcslpmanrdrallpdadrldvtrtpvphvafghgihhclgaaltrlqlriaytalwr
rfpalqladpaqeimfrtstpaygltsllvaw

Sequence, based on observed residues (ATOM records): (download)

>d6fshd_ a.104.1.0 (D:) automated matches {Actinoplanes teichomyceticus [TaxId: 1867]}
ppihtrrqgfdpadelraagtltkisiaettwlaaghavvrqvlgdhqqfstrrrwiggk
gifrprelvgnlmdydppehtrlrhlltpgftqrrmrrlaprieeivtdrldameqagpp
adlielfadevpgavlceligvprddrdmfmklchghldaslsqkrraalgdkfsrylla
miarerkdpgdgfigsivaehgdtitdeelrgvcvqlmlagddnvsgmiglgvlallrhp
eqiaalrgddqsadravdeliryltvpyaptprtavedvmvadqvikegetvlcslpman
rdrallpdadrldvtrtpvphvafghgihhclgaaltrlqlriaytalwrrfpalqladp
aqeimfrtstpaygltsllvaw

SCOPe Domain Coordinates for d6fshd_:

Click to download the PDB-style file with coordinates for d6fshd_.
(The format of our PDB-style files is described here.)

Timeline for d6fshd_:

  • d6fshd_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-24