Lineage for d6deja_ (6dej A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2546828Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2547260Protein automated matches [190406] (22 species)
    not a true protein
  7. 2547453Species Heteractis crispa [TaxId:175771] [188161] (2 PDB entries)
  8. 2547454Domain d6deja_: 6dej A: [352491]
    automated match to d3svna_
    complexed with 12p, cl, so4

Details for d6deja_

PDB Entry: 6dej (more details), 1.63 Å

PDB Description: the structure of hcred7, a brighter and red-shifted hcred variant
PDB Compounds: (A:) GFP-like non-fluorescent chromoprotein

SCOPe Domain Sequences for d6deja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6deja_ d.22.1.1 (A:) automated matches {Heteractis crispa [TaxId: 175771]}
agllkesmrikmymegtvnghyfkcegegdgnpfagtqsmrihvtegaplpfafdilapc
cesktfvhhtaeipdffkqsfpegftwertttyedggiltahqdtslegncliykvkvhg
tnfpadgpvmknksggwepstevvypengvlcgrnvmalkvgdrhlichhytsyrskkav
raltmpgfhftdyrlqmlrkkkdeyfelyeasvarysdlpekan

SCOPe Domain Coordinates for d6deja_:

Click to download the PDB-style file with coordinates for d6deja_.
(The format of our PDB-style files is described here.)

Timeline for d6deja_: