Lineage for d6fxbb_ (6fxb B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2413761Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2413784Protein beta-Lactoglobulin [50827] (4 species)
  7. 2413785Species Cow (Bos taurus) [TaxId:9913] [50828] (77 PDB entries)
    Uniprot P02754
  8. 2413814Domain d6fxbb_: 6fxb B: [352490]
    automated match to d1bsoa_
    complexed with no3, peg

Details for d6fxbb_

PDB Entry: 6fxb (more details), 2 Å

PDB Description: bovine beta-lactoglobulin variant a at ph 4.0
PDB Compounds: (B:) Major allergen beta-lactoglobulin

SCOPe Domain Sequences for d6fxbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fxbb_ b.60.1.1 (B:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi

SCOPe Domain Coordinates for d6fxbb_:

Click to download the PDB-style file with coordinates for d6fxbb_.
(The format of our PDB-style files is described here.)

Timeline for d6fxbb_: