SCOPe 2.08: Domain d6debb2: 6deb B:120-282

Lineage for d6debb2 (6deb B:120-282)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:192222] [225997] (8 PDB entries)

8. Domain d6debb2: 6deb B:120-282 [352460]
   Other proteins in same PDB: d6deba1, d6deba3, d6debb1, d6debb3
   automated match to d3p2oa2
   complexed with cl, dtt, gol, gun, k, mtx, trs

Details for d6debb2

PDB Entry: 6deb, 1.7 Å

PDB Description: crystal structure of bifunctional enzyme fold- methylenetetrahydrofolate dehydrogenase/cyclohydrolase in the complex with methotrexate from campylobacter jejuni

PDB Compounds: (B:) Bifunctional protein folD

SCOPe Domain Sequences for d6debb2:

Sequence; same for both SEQRES and ATOM records:

>d6debb2 c.2.1.0 (B:120-282) automated matches {Campylobacter jejuni [TaxId: 192222]}
fhpinvgylnlglesgflpctplgvmkllkayeidlegkdaviigasnivgrpmatmlln
agatvsvchiktkdlslytrqadliivaagcvnllrsdmvkegvivvdvginrlesgkiv
gdvdfeevskkssyitpvpggvgpmtiamllentvksaknrln

Timeline for d6debb2:

• d6debb2 first appeared in SCOPe 2.07