SCOPe 2.08: Domain d6debb1: 6deb B:1-119

Lineage for d6debb1 (6deb B:1-119)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (40 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:192222] [225996] (3 PDB entries)

8. Domain d6debb1: 6deb B:1-119 [352458]
   Other proteins in same PDB: d6deba2, d6deba3, d6debb2, d6debb3
   automated match to d3p2oa1
   complexed with cl, dtt, gol, gun, k, mtx, trs

Details for d6debb1

PDB Entry: 6deb, 1.7 Å

PDB Description: crystal structure of bifunctional enzyme fold- methylenetetrahydrofolate dehydrogenase/cyclohydrolase in the complex with methotrexate from campylobacter jejuni

PDB Compounds: (B:) Bifunctional protein folD

SCOPe Domain Sequences for d6debb1:

Sequence; same for both SEQRES and ATOM records:

>d6debb1 c.58.1.0 (B:1-119) automated matches {Campylobacter jejuni [TaxId: 192222]}
mtlldgkalsakikeelkeknqflkskgiesclavilvgdnpasqtyvkskakaceecgi
kslvyhlnenitqnellalintlnhddsvhgilvqlplpdhickdlilesiisskdvdg

Timeline for d6debb1:

• d6debb1 first appeared in SCOPe 2.07