Lineage for d6d87a_ (6d87 A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
    multihelical
  4. Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) (S)
  5. Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (6 proteins)
    Pfam PF00620
  6. Protein automated matches [334155] (2 species)
    not a true protein
  7. Species Cow (Bos taurus) [TaxId:9913] [352391] (6 PDB entries)
  8. Domain d6d87a_: 6d87 A: [352450]
    automated match to d1pbwb_
    complexed with so4; mutant

Details for d6d87a_

PDB Entry: 6d87 (more details), 2.7 Å

PDB Description: structure of the bovine p85alpha bh domain, r262t mutant
PDB Compounds: (A:) Phosphatidylinositol 3-kinase regulatory subunit alpha

SCOPe Domain Sequences for d6d87a_:

Sequence, based on SEQRES records: (download)

>d6d87a_ a.116.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
stlpdlaeqfappdvapplliklveaiekkglecstlyrtqsssnpaelrqlldcdtasl
dlemfdvhvladafkrylldlpnpvipvavsselislapevqsseeyiqllkklirspsi
phqywltlqyllkhffklsqtssknllnatvlselfspllfrfpaassentehlikiiei
listew

Sequence, based on observed residues (ATOM records): (download)

>d6d87a_ a.116.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
stlpdlaeqfappdvapplliklveaiekkglecstlyrtqsssnpaelrqlldldlemf
dvhvladafkrylldlpnpvipvavsselislapevqsseeyiqllkklirspsiphqyw
ltlqyllkhffklsqtssknllnatvlselfspllfrfssentehlikiieilistew

SCOPe Domain Coordinates for d6d87a_ are not available.

Timeline for d6d87a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6d87b_