Lineage for d6d82a_ (6d82 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725242Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
    multihelical
  4. 2725243Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) (S)
  5. 2725244Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (6 proteins)
    Pfam PF00620
  6. 2725267Protein automated matches [334155] (2 species)
    not a true protein
  7. 2725268Species Cow (Bos taurus) [TaxId:9913] [352391] (6 PDB entries)
  8. 2725277Domain d6d82a_: 6d82 A: [352438]
    automated match to d1pbwb_
    complexed with so4

Details for d6d82a_

PDB Entry: 6d82 (more details), 2.41 Å

PDB Description: structure of the bovine p85a bh domain
PDB Compounds: (A:) Phosphatidylinositol 3-kinase regulatory subunit alpha

SCOPe Domain Sequences for d6d82a_:

Sequence, based on SEQRES records: (download)

>d6d82a_ a.116.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
stlpdlaeqfappdvapplliklvkaiekkglecstlyrtqsssnpaelrqlldcdtasl
dlemfdvhvladafkrylldlpnpvipvavsselislapevqsseeyiqllkklirspsi
phqywltlqyllkhffklsqtssknllnarvlselfspllfrfpaassentehlikiiei
listew

Sequence, based on observed residues (ATOM records): (download)

>d6d82a_ a.116.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
stlpdlaeqfappdvapplliklvkaiekkglecstlyrtqsssnpaelrqlldcldlem
fdvhvladafkrylldlpnpvipvavsselislapevqsseeyiqllkklirspsiphqy
wltlqyllkhffklsqtssknllnarvlselfspllfrfpaassentehlikiieilist
ew

SCOPe Domain Coordinates for d6d82a_:

Click to download the PDB-style file with coordinates for d6d82a_.
(The format of our PDB-style files is described here.)

Timeline for d6d82a_: