Lineage for d6deba2 (6deb A:120-282)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846457Species Campylobacter jejuni [TaxId:192222] [225997] (8 PDB entries)
  8. 2846464Domain d6deba2: 6deb A:120-282 [352434]
    Other proteins in same PDB: d6deba1, d6deba3, d6debb1, d6debb3
    automated match to d3p2oa2
    complexed with cl, dtt, gol, gun, k, mtx, trs

Details for d6deba2

PDB Entry: 6deb (more details), 1.7 Å

PDB Description: crystal structure of bifunctional enzyme fold- methylenetetrahydrofolate dehydrogenase/cyclohydrolase in the complex with methotrexate from campylobacter jejuni
PDB Compounds: (A:) Bifunctional protein folD

SCOPe Domain Sequences for d6deba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6deba2 c.2.1.0 (A:120-282) automated matches {Campylobacter jejuni [TaxId: 192222]}
fhpinvgylnlglesgflpctplgvmkllkayeidlegkdaviigasnivgrpmatmlln
agatvsvchiktkdlslytrqadliivaagcvnllrsdmvkegvivvdvginrlesgkiv
gdvdfeevskkssyitpvpggvgpmtiamllentvksaknrln

SCOPe Domain Coordinates for d6deba2:

Click to download the PDB-style file with coordinates for d6deba2.
(The format of our PDB-style files is described here.)

Timeline for d6deba2: