| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins) automatically mapped to Pfam PF12680 automatically mapped to Pfam PF02136 |
| Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (3 species) |
| Species Pseudomonas putida [TaxId:303] [54437] (61 PDB entries) Uniprot P07445 |
| Domain d6f50a_: 6f50 A: [352430] automated match to d1opya_ |
PDB Entry: 6f50 (more details), 2 Å
SCOPe Domain Sequences for d6f50a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6f50a_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
lptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqglg
ggkvracltgpvrashngcgampfriemvwngqpcavdvidvmrfdehgriqtmqaywse
vnlsv
Timeline for d6f50a_: