Lineage for d2otcc1 (2otc C:1-150)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 591696Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 591697Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) (S)
  5. 591698Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)
  6. 591874Protein Ornithine transcarbamoylase [53676] (6 species)
  7. 591880Species Escherichia coli [TaxId:562] [53678] (3 PDB entries)
  8. 591891Domain d2otcc1: 2otc C:1-150 [35238]

Details for d2otcc1

PDB Entry: 2otc (more details), 2.8 Å

PDB Description: ornithine transcarbamoylase complexed with n-(phosphonacetyl)-l-ornithine

SCOP Domain Sequences for d2otcc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otcc1 c.78.1.1 (C:1-150) Ornithine transcarbamoylase {Escherichia coli}
sgfyhkhflklldftpaelnsllqlaaklkadkksgkeeakltgknialifekdstrtrc
sfevaaydqgarvtylgpsgsqighkesikdtarvlgrmydgiqyrgygqeivetlaeya
rvpvwngltnefhptqlladlltmqehlpg

SCOP Domain Coordinates for d2otcc1:

Click to download the PDB-style file with coordinates for d2otcc1.
(The format of our PDB-style files is described here.)

Timeline for d2otcc1: