SCOPe 2.08: Domain d6bbea1: 6bbe A:204-234

Lineage for d6bbea1 (6bbe A:204-234)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family)

5. Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)

6. Protein Surfactant protein [57949] (3 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [352369] (2 PDB entries)

8. Domain d6bbea1: 6bbe A:204-234 [352372]
   Other proteins in same PDB: d6bbea2
   automated match to d4e52a1
   complexed with 1pg, ca

Details for d6bbea1

PDB Entry: 6bbe, 1.9 Å

PDB Description: structure of n-glycosylated porcine surfactant protein-d

PDB Compounds: (A:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d6bbea1:

Sequence; same for both SEQRES and ATOM records:

>d6bbea1 h.1.1.1 (A:204-234) Surfactant protein {Pig (Sus scrofa) [TaxId: 9823]}
italrqqvetlqgqvqrlqkafsqykkvelf

Timeline for d6bbea1:

• d6bbea1 first appeared in SCOPe 2.07