Lineage for d6cd0d_ (6cd0 D:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. Protein automated matches [190152] (25 species)
    not a true protein
  7. Species Medicago truncatula [TaxId:3880] [352361] (3 PDB entries)
  8. Domain d6cd0d_: 6cd0 D: [352367]
    automated match to d1bj4a_
    complexed with act, fmt

Details for d6cd0d_

PDB Entry: 6cd0 (more details), 1.7400000000000002 Å

PDB Description: crystal structure of medicago truncatula serine hydroxymethyltransferase 3 (mtshmt3), plp-internal aldimine and apo form
PDB Compounds: (D:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d6cd0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cd0d_ c.67.1.4 (D:) automated matches {Medicago truncatula [TaxId: 3880]}
fldyglseadpdvhaiinkekdrqfrsleliasenftskavmeavgscltnkyseglpgk
ryyggnehideleilcqqralaafhldgdkwgvnvqplsgspanfavytailkphdrimg
ldlphgghlshgfmtakrrvsgtsiyfesmpyrldestgvidydmlektaalfrpkliia
gasayprdidyarfrkiadsvgaflmmdmahvsgliaasvladpfefvdivtttthkslr
gprggmiffkkdavhgvdlesainnavfpglqggphnhtigglavclkyaqspdfknyqn
qvvancralanrlveheyklvsggsdnhlvlvdlrpsgidgarvekildmasitlnknsv
pgdksalvpggirigspamttrglgekefeliadlihegvrisleakslvsgtkvqdfln
fvlapefplgdkvsnlrrkvealatqypipgv

SCOPe Domain Coordinates for d6cd0d_ are not available.

Timeline for d6cd0d_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6cd0a_, d6cd0b_, d6cd0c_