Lineage for d6bdya_ (6bdy A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.173: Methionine synthase activation domain-like [56506] (1 superfamily)
    unusual fold; core: beta-alpha(2)-beta(2)-alpha(2)-beta-alpha-beta; antiparallel beta-sheet: order 12354
  4. Superfamily d.173.1: Methionine synthase activation domain-like [56507] (3 families) (S)
  5. Family d.173.1.1: Methionine synthase SAM-binding domain [56508] (2 proteins)
  6. Protein automated matches [352355] (1 species)
    not a true protein
  7. Species Escherichia coli [TaxId:83333] [352356] (3 PDB entries)
  8. Domain d6bdya_: 6bdy A: [352357]
    automated match to d1mska_
    complexed with sfg

Details for d6bdya_

PDB Entry: 6bdy (more details), 1.51 Å

PDB Description: crystal structure of the meth reactivation domain bound to sinefungin
PDB Compounds: (A:) methionine synthase

SCOPe Domain Sequences for d6bdya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bdya_ d.173.1.1 (A:) automated matches {Escherichia coli [TaxId: 83333]}
tppvtleaardndfafdwqaytppvahrlgvqeveasietlrnyidwtpffmtwslagky
priledevvgveaqrlfkdandmldklsaektlnprgvvglfpanrvgddieiyrdetrt
hvinvshhlrqqtektgfanycladfvapklsgkadyigafavtggleedaladafeaqh
ddynkimvkaladrlaeafaeylhervrkvywgyapnenlsneelirenyqgirpapgyp
acpehtekatiwellevekhtgmkltesfamwpgasvsgwyfshpdskyyavaqiqrdqv
edyarrkgmsvteverwlapnlgyda

SCOPe Domain Coordinates for d6bdya_ are not available.

Timeline for d6bdya_: