Lineage for d5zlka2 (5zlk A:183-356)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381028Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2381700Protein Spore coat protein A, CotA [89219] (2 species)
  7. 2381741Species Bacillus subtilis [TaxId:224308] [271928] (8 PDB entries)
  8. 2381770Domain d5zlka2: 5zlk A:183-356 [352347]
    automated match to d1gska2
    complexed with cu, edo, gol; mutant

Details for d5zlka2

PDB Entry: 5zlk (more details), 2.6 Å

PDB Description: mutation in the trinuclear site of cota-laccase: h493a mutant, ph 8.0
PDB Compounds: (A:) spore coat protein a

SCOPe Domain Sequences for d5zlka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zlka2 b.6.1.3 (A:183-356) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 224308]}
klpsdeydvpllitdrtinedgslfypsapenpspslpnpsivpafcgetilvngkvwpy
leveprkyrfrvinasntrtynlsldnggdfiqigsdggllprsvklnsfslapaerydi
iidftayegesiilansagcggdvnpetdanimqfrvtkplaqkdesrkpkyla

SCOPe Domain Coordinates for d5zlka2:

Click to download the PDB-style file with coordinates for d5zlka2.
(The format of our PDB-style files is described here.)

Timeline for d5zlka2: