Lineage for d6amhd_ (6amh D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907393Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2907681Protein automated matches [190054] (13 species)
    not a true protein
  7. 2907710Species Pyrococcus furiosus [TaxId:186497] [279274] (16 PDB entries)
  8. 2907722Domain d6amhd_: 6amh D: [352336]
    Other proteins in same PDB: d6amhb2
    automated match to d1v8zb_
    complexed with na, pls

Details for d6amhd_

PDB Entry: 6amh (more details), 1.63 Å

PDB Description: engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb4d11 with ser bound as e(aex1)
PDB Compounds: (D:) Tryptophan synthase beta chain 1

SCOPe Domain Sequences for d6amhd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6amhd_ c.79.1.1 (D:) automated matches {Pyrococcus furiosus [TaxId: 186497]}
mwfgefggqyvpetligplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
ekiggakvylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
ndkkvklvgveaggkglesgkhsaslnagqvgvshgmlsyflqdeegqikpshsiapgld
ypgvgpehaylkkiqraeyvavtdeealkafhelsrtegiipalesahavayamklakem
srdeiiivnlsgrgdkdldivlkvs

SCOPe Domain Coordinates for d6amhd_:

Click to download the PDB-style file with coordinates for d6amhd_.
(The format of our PDB-style files is described here.)

Timeline for d6amhd_: