Lineage for d5tw4b2 (5tw4 B:316-383)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily)
    sandwich; 6 strands in 2 sheets
  4. Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families) (S)
  5. Family b.105.1.0: automated matches [231757] (1 protein)
    not a true family
  6. Protein automated matches [231758] (5 species)
    not a true protein
  7. Species Staphylococcus aureus [TaxId:93062] [352204] (11 PDB entries)
  8. Domain d5tw4b2: 5tw4 B:316-383 [352335]
    Other proteins in same PDB: d5tw4a1, d5tw4b1
    automated match to d3huma2
    complexed with ai8, cl, gol, na, zn; mutant

Details for d5tw4b2

PDB Entry: 5tw4 (more details), 1.57 Å

PDB Description: crystal structure of s. aureus penicillin binding protein 4 (pbp4) mutant (e183a, f241r) in complex with ceftaroline
PDB Compounds: (B:) Penicillin-binding protein 4

SCOPe Domain Sequences for d5tw4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tw4b2 b.105.1.0 (B:316-383) automated matches {Staphylococcus aureus [TaxId: 93062]}
kyvkilskgeqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdyg
pptvevhq

SCOPe Domain Coordinates for d5tw4b2 are not available.

Timeline for d5tw4b2:

Domains from same chain:
(mouse over for more information)
d5tw4b1
Domains from other chains:
(mouse over for more information)
d5tw4a1, d5tw4a2