Lineage for d5o6ha2 (5o6h A:296-496)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. Protein automated matches [190038] (49 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [225745] (65 PDB entries)
  8. Domain d5o6ha2: 5o6h A:296-496 [352324]
    automated match to d3iu1a2
    complexed with 9m2, dms, gol, mg, mya, po4

Details for d5o6ha2

PDB Entry: 5o6h (more details), 1.29 Å

PDB Description: human nmt1 in complex with myristoyl-coa and inhibitor imp-917
PDB Compounds: (A:) Glycylpeptide N-tetradecanoyltransferase 1

SCOPe Domain Sequences for d5o6ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o6ha2 d.108.1.0 (A:296-496) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ywhrslnprklievkfshlsrnmtmqrtmklyrlpetpktaglrpmetkdipvvhqlltr
ylkqfhltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlpstimnhpthks
lkaaysfynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktfleklkfgigdgnlq
yylynwkcpsmgaekvglvlq

SCOPe Domain Coordinates for d5o6ha2 are not available.

Timeline for d5o6ha2:

Domains from same chain:
(mouse over for more information)
d5o6ha1
Domains from other chains:
(mouse over for more information)
d5o6hb1, d5o6hb2