SCOPe 2.08: Domain d5o6ha1: 5o6h A:115-295

Lineage for d5o6ha1 (5o6h A:115-295)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (49 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225745] (65 PDB entries)

8. Domain d5o6ha1: 5o6h A:115-295 [352323]
   automated match to d3iu1a1
   complexed with 9m2, dms, gol, mg, mya, po4

Details for d5o6ha1

PDB Entry: 5o6h, 1.29 Å

PDB Description: human nmt1 in complex with myristoyl-coa and inhibitor imp-917

PDB Compounds: (A:) Glycylpeptide N-tetradecanoyltransferase 1

SCOPe Domain Sequences for d5o6ha1:

Sequence; same for both SEQRES and ATOM records:

>d5o6ha1 d.108.1.0 (A:115-295) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsyqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgdrgvlkelyt
llnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgfisaipanih
iydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkpvgtc
r

Timeline for d5o6ha1:

• d5o6ha1 first appeared in SCOPe 2.07