Lineage for d1duvi1 (1duv I:1-150)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906434Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. 2906745Protein Ornithine transcarbamoylase [53676] (6 species)
  7. 2906746Species Escherichia coli [TaxId:562] [53678] (3 PDB entries)
  8. 2906751Domain d1duvi1: 1duv I:1-150 [35232]
    complexed with mpd, psq

Details for d1duvi1

PDB Entry: 1duv (more details), 1.7 Å

PDB Description: crystal structure of e. coli ornithine transcarbamoylase complexed with ndelta-l-ornithine-diaminophosphinyl-n-sulphonic acid (psorn)
PDB Compounds: (I:) ornithine transcarbamoylase

SCOPe Domain Sequences for d1duvi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1duvi1 c.78.1.1 (I:1-150) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]}
sgfyhkhflklldftpaelnsllqlaaklkadkksgkeeakltgknialifekdstrtrc
sfevaaydqgarvtylgpsgsqighkesikdtarvlgrmydgiqyrgygqeivetlaeya
svpvwngltnefhptqlladlltmqehlpg

SCOPe Domain Coordinates for d1duvi1:

Click to download the PDB-style file with coordinates for d1duvi1.
(The format of our PDB-style files is described here.)

Timeline for d1duvi1: