Lineage for d5zlma1 (5zlm A:2-182)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. Protein Spore coat protein A, CotA, N- and C-terminal domain [418912] (2 species)
  7. Species Bacillus subtilis [TaxId:224308] [419336] (8 PDB entries)
  8. Domain d5zlma1: 5zlm A:2-182 [352295]
    Other proteins in same PDB: d5zlma2
    automated match to d1gska1
    complexed with cu, edo, gol; mutant

Details for d5zlma1

PDB Entry: 5zlm (more details), 1.7000000000000002 Å

PDB Description: mutation in the trinuclear site of cota-laccase: h491c mutant, ph 8.0
PDB Compounds: (A:) spore coat protein a

SCOPe Domain Sequences for d5zlma1:

Sequence, based on SEQRES records: (download)

>d5zlma1 b.6.1.3 (A:2-182) Spore coat protein A, CotA, N- and C-terminal domain {Bacillus subtilis [TaxId: 224308]}
tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
vkrnenvyvkwmnnlpsthflpidhtihhsdsqheepevktvvhlhggvtpddsdgypea
wfskdfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekr
l

Sequence, based on observed residues (ATOM records): (download)

>d5zlma1 b.6.1.3 (A:2-182) Spore coat protein A, CotA, N- and C-terminal domain {Bacillus subtilis [TaxId: 224308]}
tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
vkrnenvyvkwmnnlpsthflpidhtihhseepevktvvhlhggvtpddsdgypeawfsk
dfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekrl

SCOPe Domain Coordinates for d5zlma1 are not available.

Timeline for d5zlma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5zlma2, d5zlma3