SCOPe 2.08: Domain d1ortl2: 1ort L:151-335

Lineage for d1ortl2 (1ort L:151-335)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)

6. Protein Ornithine transcarbamoylase [53676] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [53677] (2 PDB entries)

8. Domain d1ortl2: 1ort L:151-335 [35227]

Details for d1ortl2

PDB Entry: 1ort, 3 Å

PDB Description: ornithine transcarbamoylase from pseudomonas aeruginosa

PDB Compounds: (L:) ornithine transcarbamoylase

SCOPe Domain Sequences for d1ortl2:

Sequence; same for both SEQRES and ATOM records:

>d1ortl2 c.78.1.1 (L:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]}
kplhdisyaylgdarnnmgnsllligaklgmdvriaapkalwphdefvaqckkfaeesga
kltltedpkeavkgvdfvhtdvwvsmgepveawgerikellpyqvnmeimkatgnprakf
mhclpafhnsetkvgkqiaeqypnlangievtedvfespyniafeqaenrmhtikailvs
tladi

Timeline for d1ortl2:

• d1ortl2 first appeared (with stable ids) in SCOP 1.55
  
• d1ortl2 appears in SCOPe 2.07