SCOP 1.55: Domain d1ortl1: 1ort L:1-150

Lineage for d1ortl1 (1ort L:1-150)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (2 proteins)

6. Protein Ornithine transcarbamoylase [53676] (4 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [53677] (2 PDB entries)

8. Domain d1ortl1: 1ort L:1-150 [35226]

Details for d1ortl1

PDB Entry: 1ort, 3 Å

PDB Description: ornithine transcarbamoylase from pseudomonas aeruginosa

SCOP Domain Sequences for d1ortl1:

Sequence; same for both SEQRES and ATOM records:

>d1ortl1 c.78.1.1 (L:1-150) Ornithine transcarbamoylase {Pseudomonas aeruginosa}
afnmhnrnllslmhhstrelrylldlsrdlkrakytgteqqhlkrknialifektstrtr
cafevaaydqganvtyidpnssqighkesmkdtarvlgrmydaigyrgfkqeiveelakf
agvpvfngltdeyhptqmladvltmrehsd

Timeline for d1ortl1:

• d1ortl1 appears in SCOP 1.57
  
• d1ortl1 appears in the current release, SCOPe 2.08