Lineage for d5xqra_ (5xqr A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427209Superfamily b.85.1: AFP III-like domain [51269] (2 families) (S)
    duplication: consists of two structural repeats related by pseudo dyad
  5. 2427210Family b.85.1.1: AFP III-like domain [51270] (4 proteins)
    Pfam PF01354
  6. 2427267Protein automated matches [191302] (4 species)
    not a true protein
  7. 2427272Species Zoarces elongatus [TaxId:291231] [255465] (8 PDB entries)
  8. 2427282Domain d5xqra_: 5xqr A: [352256]
    automated match to d4ur6a_
    complexed with act; mutant

Details for d5xqra_

PDB Entry: 5xqr (more details), 1.3 Å

PDB Description: crystal structure of notched-fin eelpout type iii antifreeze protein a20v mutant (nfe6, afp), c2221 form
PDB Compounds: (A:) Ice-structuring protein

SCOPe Domain Sequences for d5xqra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xqra_ b.85.1.1 (A:) automated matches {Zoarces elongatus [TaxId: 291231]}
gesvvatqlipintaltpvmmegkvtnpsgipfaemsqivgkqvntpvakgqtlmpgmvk
tyvp

SCOPe Domain Coordinates for d5xqra_:

Click to download the PDB-style file with coordinates for d5xqra_.
(The format of our PDB-style files is described here.)

Timeline for d5xqra_: