SCOPe 2.08: Domain d5xqnb_: 5xqn B:

Lineage for d5xqnb_ (5xqn B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.1: AFP III-like domain [51269] (2 families)
   duplication: consists of two structural repeats related by pseudo dyad

5. Family b.85.1.1: AFP III-like domain [51270] (4 proteins)
   Pfam PF01354

6. Protein automated matches [191302] (4 species)
   not a true protein

7. Species Zoarces elongatus [TaxId:291231] [255465] (8 PDB entries)

8. Domain d5xqnb_: 5xqn B: [352254]
   automated match to d4ur6a_
   complexed with so4

Details for d5xqnb_

PDB Entry: 5xqn, 1.19 Å

PDB Description: crystal structure of notched-fin eelpout type iii antifreeze protein (nfe6, afp), c2221 form.

PDB Compounds: (B:) Ice-structuring protein

SCOPe Domain Sequences for d5xqnb_:

Sequence; same for both SEQRES and ATOM records:

>d5xqnb_ b.85.1.1 (B:) automated matches {Zoarces elongatus [TaxId: 291231]}
gesvvatqlipintaltpammegkvtnpsgipfaemsqivgkqvntpvakgqtlmpgmvk
ty

Timeline for d5xqnb_:

• d5xqnb_ first appeared in SCOPe 2.07