Lineage for d1ortk1 (1ort K:1-150)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2156150Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2156151Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2156152Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. 2156471Protein Ornithine transcarbamoylase [53676] (6 species)
  7. 2156514Species Pseudomonas aeruginosa [TaxId:287] [53677] (2 PDB entries)
  8. 2156537Domain d1ortk1: 1ort K:1-150 [35224]

Details for d1ortk1

PDB Entry: 1ort (more details), 3 Å

PDB Description: ornithine transcarbamoylase from pseudomonas aeruginosa
PDB Compounds: (K:) ornithine transcarbamoylase

SCOPe Domain Sequences for d1ortk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ortk1 c.78.1.1 (K:1-150) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]}
afnmhnrnllslmhhstrelrylldlsrdlkrakytgteqqhlkrknialifektstrtr
cafevaaydqganvtyidpnssqighkesmkdtarvlgrmydaigyrgfkqeiveelakf
agvpvfngltdeyhptqmladvltmrehsd

SCOPe Domain Coordinates for d1ortk1:

Click to download the PDB-style file with coordinates for d1ortk1.
(The format of our PDB-style files is described here.)

Timeline for d1ortk1: