SCOPe 2.05: Domain d1ortk1: 1ort K:1-150

Lineage for d1ortk1 (1ort K:1-150)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)

6. Protein Ornithine transcarbamoylase [53676] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [53677] (2 PDB entries)

8. Domain d1ortk1: 1ort K:1-150 [35224]

Details for d1ortk1

PDB Entry: 1ort, 3 Å

PDB Description: ornithine transcarbamoylase from pseudomonas aeruginosa

PDB Compounds: (K:) ornithine transcarbamoylase

SCOPe Domain Sequences for d1ortk1:

Sequence; same for both SEQRES and ATOM records:

>d1ortk1 c.78.1.1 (K:1-150) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]}
afnmhnrnllslmhhstrelrylldlsrdlkrakytgteqqhlkrknialifektstrtr
cafevaaydqganvtyidpnssqighkesmkdtarvlgrmydaigyrgfkqeiveelakf
agvpvfngltdeyhptqmladvltmrehsd

Timeline for d1ortk1:

• d1ortk1 first appeared (with stable ids) in SCOP 1.55
  
• d1ortk1 appears in SCOPe 2.04
  
• d1ortk1 appears in SCOPe 2.06
  
• d1ortk1 appears in the current release, SCOPe 2.08