SCOPe 2.07: Domain d6c1ea_: 6c1e A:

Lineage for d6c1ea_ (6c1e A:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families)
   Pfam PF00520

5. Family f.14.1.2: Voltage-gated Na/Ca cation channels [310631] (4 proteins)
   Pfam PF08016

6. Protein NavAb sodium channel [310744] (1 species)

7. Species Arcobacter butzleri [TaxId:367737] [310997] (16 PDB entries)

8. Domain d6c1ea_: 6c1e A: [352235]
   automated match to d3rvya_
   complexed with bnc, px4, uhh; mutant

Details for d6c1ea_

PDB Entry: 6c1e, 2.86 Å

PDB Description: navab normopp mutant

PDB Compounds: (A:) Ion transport protein

SCOPe Domain Sequences for d6c1ea_:

Sequence; same for both SEQRES and ATOM records:

>d6c1ea_ f.14.1.2 (A:) NavAb sodium channel {Arcobacter butzleri [TaxId: 367737]}
mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
ilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlrvlglfrlvtavpqmrkiv
salisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtlesws
mgivrplmevypyawvffipfifvvtfvminlvvaicvdam

Timeline for d6c1ea_:

• d6c1ea_ is new in SCOPe 2.07-stable
  
• d6c1ea_ appears in the current release, SCOPe 2.08