| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
| Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
| Protein automated matches [190753] (21 species) not a true protein |
| Species Synechocystis sp. [TaxId:1111708] [352162] (4 PDB entries) |
| Domain d5o3qa1: 5o3q A:2-110 [352193] Other proteins in same PDB: d5o3qa2, d5o3qb2, d5o3qc2 automated match to d3dfeb_ complexed with bct, cmp |
PDB Entry: 5o3q (more details), 1.75 Å
SCOPe Domain Sequences for d5o3qa1:
Sequence, based on SEQRES records: (download)
>d5o3qa1 d.58.5.0 (A:2-110) automated matches {Synechocystis sp. [TaxId: 1111708]}
akpanklvivtekillkkiakiidesgakgytvmntggkgsrnvrssgqpntsdieanik
feiltetremaeeiadrvavkyfndyagiiyicsaevlyghtfcgpegc
>d5o3qa1 d.58.5.0 (A:2-110) automated matches {Synechocystis sp. [TaxId: 1111708]}
akpanklvivtekillkkiakiidesgakgytvmntggkgsdieanikfeiltetremae
eiadrvavkyfndyagiiyicsaevlyghtfcgpegc
Timeline for d5o3qa1:
View in 3DDomains from other chains: (mouse over for more information) d5o3qb1, d5o3qb2, d5o3qc1, d5o3qc2 |