SCOPe 2.08: Domain d5ok4a2: 5ok4 A:245-344

Lineage for d5ok4a2 (5ok4 A:245-344)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Methanothermobacter marburgensis [TaxId:79929] [235008] (4 PDB entries)

8. Domain d5ok4a2: 5ok4 A:245-344 [352185]
   Other proteins in same PDB: d5ok4a1
   automated match to d4jjfa2
   complexed with fe, feg, gol

Details for d5ok4a2

PDB Entry: 5ok4, 1.29 Å

PDB Description: crystal structure of native [fe]-hydrogenase hmd from methanothermobacter marburgensis inactivated by o2.

PDB Compounds: (A:) 5,10-methenyltetrahydromethanopterin hydrogenase

SCOPe Domain Sequences for d5ok4a2:

Sequence; same for both SEQRES and ATOM records:

>d5ok4a2 a.100.1.0 (A:245-344) automated matches {Methanothermobacter marburgensis [TaxId: 79929]}
aellgpvcdmcsaltaityagilsyrdsvtqvlgapasfaqmmakesleqitalmekvgi
dkmeenldpgallgtadsmnfgasaeilptvfeilekrkk

Timeline for d5ok4a2:

• d5ok4a2 first appeared in SCOPe 2.07